PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS753559.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family YABBY
Protein Properties Length: 117aa    MW: 13051.8 Da    PI: 10.0182
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS753559.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY141.59e-441680106170
         YABBY 106 deevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                    e++p++p v+rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+ihfgl
  EcS753559.10  16 AEQIPKPPVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 80 
                   6889**999******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.0E-391780IPR006780YABBY protein
SuperFamilySSF470951.14E-82373IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.1E-52874IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0009933Biological Processmeristem structural organization
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010093Biological Processspecification of floral organ identity
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:0010159Biological Processspecification of organ position
GO:0010450Biological Processinflorescence meristem growth
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
NQLSPADSIM QLRGGAEQIP KPPVVNRPPE KRQRVPSAYN RFIKEEIQRI KAGNPDISHR  60
EAFSAAAKNW AHFPHIHFGL MPDQPVKKTN ICQQEGEDVL RKDGGLFATA NVGVSPY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00620PBMTransfer from AT2G45190Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053914.12e-83PREDICTED: axial regulator YABBY 1
SwissprotO221521e-53YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A059CJD32e-83A0A059CJD3_EUCGR; Uncharacterized protein
STRINGSolyc01g091010.2.16e-65(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22172877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.16e-55YABBY family protein